PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g20090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family WRKY
Protein Properties Length: 508aa    MW: 57488.1 Da    PI: 7.5344
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g20090genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.11.1e-3085142260
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                 dDgy+WrKYGqK+vkgs+fprsYY+Ct+++Cpv+kkve++  +++v+ei+Y+g Hnh+k
  CA05g20090  85 DDGYTWRKYGQKHVKGSNFPRSYYKCTQQTCPVRKKVECAP-NGQVIEIVYNGPHNHPK 142
                 8****************************************.***************85 PP

2WRKY105.82.3e-33295352259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +Dgy+WrKYGqK+vkg+++prsYY+CtsagC v+k+ver+++d k v++tYeg+Hnhe
  CA05g20090 295 EDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCLVRKHVERASDDLKSVITTYEGKHNHE 352
                 8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.1E-2776142IPR003657WRKY domain
PROSITE profilePS5081122.13679143IPR003657WRKY domain
SuperFamilySSF1182904.84E-2481142IPR003657WRKY domain
SMARTSM007741.2E-3284142IPR003657WRKY domain
PfamPF031062.6E-2485141IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-35279354IPR003657WRKY domain
SuperFamilySSF1182902.75E-28288354IPR003657WRKY domain
PROSITE profilePS5081137.631289354IPR003657WRKY domain
SMARTSM007742.6E-38294353IPR003657WRKY domain
PfamPF031061.9E-25295352IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MEALEQLVKL LPCDQRVTHG FKLWKQPLPE LQDKTPTDNV AQILHCIEST NNQIPQQQQE  60
FTKKQNQFEQ RGIFSSSISP NNSSDDGYTW RKYGQKHVKG SNFPRSYYKC TQQTCPVRKK  120
VECAPNGQVI EIVYNGPHNH PKTQHLRRKA MDADSYVVGQ ENGSSSSSLI WRNDQQLEYN  180
KDVNSCCNEL ERKPSASVLS DVSSDPMLSN NLKSMNVFES DATHELSSTL NSFDDEDEDL  240
ATQEGNFLGD GINEFEFEPK RRKKESYSVE PSLLSRTVRE PKVVLQVESE TDILEDGYRW  300
RKYGQKVVKG NPNPRSYYKC TSAGCLVRKH VERASDDLKS VITTYEGKHN HEVPSANKTN  360
GVAGHFRSAS MLNNGQQQPA CTASRKSLKD SNIRVQFQDL PIPFERKFFM GSEYLRPNFG  420
ASYLSDLSFG GGSLQLPDFA IPLPLPSRMS FPARQNEPRL GDFQMNNHLL LPNGASTFLA  480
AGNTRHINDD NNNSRLLKAK DEVQYWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-3285355878Probable WRKY transcription factor 4
2lex_A2e-3285355878Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1258264PKRRKKE
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2387893e-53AC238789.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 5 clone C05HBa0142A20, complete sequence.
GenBankHG9754443e-53HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755173e-53HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016573837.10.0PREDICTED: probable WRKY transcription factor 26
TrEMBLM1C5480.0M1C548_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000600420.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57672237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.15e-66WRKY DNA-binding protein 33